Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for objph9 191. objph9 Lv 1 1 pt. 7,118
  2. Avatar for Alex333 192. Alex333 Lv 1 1 pt. 7,027
  3. Avatar for Betzalel 193. Betzalel Lv 1 1 pt. 6,951
  4. Avatar for Sageca 194. Sageca Lv 1 1 pt. 6,836
  5. Avatar for akueser 195. akueser Lv 1 1 pt. 6,732
  6. Avatar for HeraticXYZ 196. HeraticXYZ Lv 1 1 pt. 6,709
  7. Avatar for njfuzjs 197. njfuzjs Lv 1 1 pt. 6,695
  8. Avatar for penteplayer 198. penteplayer Lv 1 1 pt. 6,659
  9. Avatar for apew777 199. apew777 Lv 1 1 pt. 6,559
  10. Avatar for Marvelz 200. Marvelz Lv 1 1 pt. 6,557

Comments