Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for objph9 191. objph9 Lv 1 1 pt. 7,118
  2. Avatar for Alex333 192. Alex333 Lv 1 1 pt. 7,027
  3. Avatar for Betzalel 193. Betzalel Lv 1 1 pt. 6,951
  4. Avatar for Sageca 194. Sageca Lv 1 1 pt. 6,836
  5. Avatar for akueser 195. akueser Lv 1 1 pt. 6,732
  6. Avatar for HeraticXYZ 196. HeraticXYZ Lv 1 1 pt. 6,709
  7. Avatar for njfuzjs 197. njfuzjs Lv 1 1 pt. 6,695
  8. Avatar for penteplayer 198. penteplayer Lv 1 1 pt. 6,659
  9. Avatar for apew777 199. apew777 Lv 1 1 pt. 6,559
  10. Avatar for Marvelz 200. Marvelz Lv 1 1 pt. 6,557

Comments