Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for smilingone 41. smilingone Lv 1 40 pts. 8,877
  2. Avatar for gurch 42. gurch Lv 1 39 pts. 8,866
  3. Avatar for Satina 43. Satina Lv 1 38 pts. 8,864
  4. Avatar for Bushman 44. Bushman Lv 1 37 pts. 8,856
  5. Avatar for crpainter 45. crpainter Lv 1 36 pts. 8,855
  6. Avatar for jobo0502 46. jobo0502 Lv 1 35 pts. 8,854
  7. Avatar for Blipperman 47. Blipperman Lv 1 34 pts. 8,853
  8. Avatar for diamond_dust 48. diamond_dust Lv 1 34 pts. 8,853
  9. Avatar for pauldunn 49. pauldunn Lv 1 33 pts. 8,849
  10. Avatar for kitek314_pl 50. kitek314_pl Lv 1 32 pts. 8,847

Comments