Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for smilingone 41. smilingone Lv 1 40 pts. 8,877
  2. Avatar for gurch 42. gurch Lv 1 39 pts. 8,866
  3. Avatar for Satina 43. Satina Lv 1 38 pts. 8,864
  4. Avatar for Bushman 44. Bushman Lv 1 37 pts. 8,856
  5. Avatar for crpainter 45. crpainter Lv 1 36 pts. 8,855
  6. Avatar for jobo0502 46. jobo0502 Lv 1 35 pts. 8,854
  7. Avatar for Blipperman 47. Blipperman Lv 1 34 pts. 8,853
  8. Avatar for diamond_dust 48. diamond_dust Lv 1 34 pts. 8,853
  9. Avatar for pauldunn 49. pauldunn Lv 1 33 pts. 8,849
  10. Avatar for kitek314_pl 50. kitek314_pl Lv 1 32 pts. 8,847

Comments