Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for andrewxc 51. andrewxc Lv 1 31 pts. 8,846
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 30 pts. 8,840
  3. Avatar for edpalas 53. edpalas Lv 1 29 pts. 8,840
  4. Avatar for Threeoak 54. Threeoak Lv 1 29 pts. 8,836
  5. Avatar for weitzen 55. weitzen Lv 1 28 pts. 8,832
  6. Avatar for pvc78 56. pvc78 Lv 1 27 pts. 8,821
  7. Avatar for SKSbell 57. SKSbell Lv 1 26 pts. 8,816
  8. Avatar for YeshuaLives 58. YeshuaLives Lv 1 26 pts. 8,814
  9. Avatar for georg137 59. georg137 Lv 1 25 pts. 8,810
  10. Avatar for WBarme1234 60. WBarme1234 Lv 1 24 pts. 8,810

Comments