Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for andrewxc 51. andrewxc Lv 1 31 pts. 8,846
  2. Avatar for Anfinsen_slept_here 52. Anfinsen_slept_here Lv 1 30 pts. 8,840
  3. Avatar for edpalas 53. edpalas Lv 1 29 pts. 8,840
  4. Avatar for Threeoak 54. Threeoak Lv 1 29 pts. 8,836
  5. Avatar for weitzen 55. weitzen Lv 1 28 pts. 8,832
  6. Avatar for pvc78 56. pvc78 Lv 1 27 pts. 8,821
  7. Avatar for SKSbell 57. SKSbell Lv 1 26 pts. 8,816
  8. Avatar for YeshuaLives 58. YeshuaLives Lv 1 26 pts. 8,814
  9. Avatar for georg137 59. georg137 Lv 1 25 pts. 8,810
  10. Avatar for WBarme1234 60. WBarme1234 Lv 1 24 pts. 8,810

Comments