Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for phi16 61. phi16 Lv 1 24 pts. 8,809
  2. Avatar for jamiexq 62. jamiexq Lv 1 23 pts. 8,804
  3. Avatar for ViJay7019 63. ViJay7019 Lv 1 22 pts. 8,801
  4. Avatar for fiendish_ghoul 64. fiendish_ghoul Lv 1 22 pts. 8,796
  5. Avatar for Giant Berk 65. Giant Berk Lv 1 21 pts. 8,791
  6. Avatar for fryguy 66. fryguy Lv 1 21 pts. 8,788
  7. Avatar for hallenberg 67. hallenberg Lv 1 20 pts. 8,779
  8. Avatar for justjustin 68. justjustin Lv 1 19 pts. 8,775
  9. Avatar for isaksson 69. isaksson Lv 1 19 pts. 8,765
  10. Avatar for fishercat 70. fishercat Lv 1 18 pts. 8,763

Comments