Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Gargleblasters
    1. Gargleblasters
    100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847
  1. Avatar for phi16 61. phi16 Lv 1 24 pts. 8,809
  2. Avatar for jamiexq 62. jamiexq Lv 1 23 pts. 8,804
  3. Avatar for ViJay7019 63. ViJay7019 Lv 1 22 pts. 8,801
  4. Avatar for fiendish_ghoul 64. fiendish_ghoul Lv 1 22 pts. 8,796
  5. Avatar for Giant Berk 65. Giant Berk Lv 1 21 pts. 8,791
  6. Avatar for fryguy 66. fryguy Lv 1 21 pts. 8,788
  7. Avatar for hallenberg 67. hallenberg Lv 1 20 pts. 8,779
  8. Avatar for justjustin 68. justjustin Lv 1 19 pts. 8,775
  9. Avatar for isaksson 69. isaksson Lv 1 19 pts. 8,765
  10. Avatar for fishercat 70. fishercat Lv 1 18 pts. 8,763

Comments