Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups

  1. Avatar for Deleted group 11. Deleted group pts. 8,840
  2. Avatar for xkcd 12. xkcd 1 pt. 8,788
  3. Avatar for It's over 9000! 13. It's over 9000! 1 pt. 8,653
  4. Avatar for freefolder 14. freefolder 1 pt. 8,249
  5. Avatar for 2015-6 Biochemistry: Drugs and Poisons 15. 2015-6 Biochemistry: Drugs and Poisons 1 pt. 8,210
  6. Avatar for FoldIt@Netherlands 16. FoldIt@Netherlands 1 pt. 8,057
  7. Avatar for Deleted group 17. Deleted group pts. 6,257
  8. Avatar for DSN @ Home 18. DSN @ Home 1 pt. 5,810
  1. Avatar for mitarcher 81. mitarcher Lv 1 13 pts. 8,690
  2. Avatar for JUMELLE54 82. JUMELLE54 Lv 1 13 pts. 8,680
  3. Avatar for stomjoh 83. stomjoh Lv 1 12 pts. 8,674
  4. Avatar for guineapig 84. guineapig Lv 1 12 pts. 8,673
  5. Avatar for Mike Lewis 85. Mike Lewis Lv 1 12 pts. 8,664
  6. Avatar for adelelopez 86. adelelopez Lv 1 11 pts. 8,655
  7. Avatar for steveB 87. steveB Lv 1 11 pts. 8,653
  8. Avatar for BCAA 88. BCAA Lv 1 11 pts. 8,653
  9. Avatar for ecali 89. ecali Lv 1 10 pts. 8,651
  10. Avatar for cbwest 90. cbwest Lv 1 10 pts. 8,644

Comments