Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847

  1. Avatar for mitarcher 81. mitarcher Lv 1 13 pts. 8,690
  2. Avatar for JUMELLE54 82. JUMELLE54 Lv 1 13 pts. 8,680
  3. Avatar for stomjoh 83. stomjoh Lv 1 12 pts. 8,674
  4. Avatar for guineapig 84. guineapig Lv 1 12 pts. 8,673
  5. Avatar for Mike Lewis 85. Mike Lewis Lv 1 12 pts. 8,664
  6. Avatar for adelelopez 86. adelelopez Lv 1 11 pts. 8,655
  7. Avatar for steveB 87. steveB Lv 1 11 pts. 8,653
  8. Avatar for BCAA 88. BCAA Lv 1 11 pts. 8,653
  9. Avatar for ecali 89. ecali Lv 1 10 pts. 8,651
  10. Avatar for cbwest 90. cbwest Lv 1 10 pts. 8,644

Comments