Placeholder image of a protein
Icon representing a puzzle

1197: Unsolved De-novo Freestyle 70

Closed since over 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 20, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TLDEIEKEIRKWLSQNRTGNLEKRDGELRLEVNNTELRITEGVHREQVKEELKKMEKQHN

Top groups


  1. Avatar for Gargleblasters 100 pts. 9,325
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 74 pts. 9,310
  3. Avatar for Beta Folders 3. Beta Folders 54 pts. 9,221
  4. Avatar for Go Science 4. Go Science 38 pts. 9,205
  5. Avatar for HMT heritage 5. HMT heritage 27 pts. 9,125
  6. Avatar for Contenders 6. Contenders 18 pts. 9,092
  7. Avatar for Void Crushers 7. Void Crushers 12 pts. 9,089
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 8 pts. 8,939
  9. Avatar for Italiani Al Lavoro 9. Italiani Al Lavoro 5 pts. 8,856
  10. Avatar for BOINC@Poland 10. BOINC@Poland 3 pts. 8,847

  1. Avatar for Paul.Goldgisser 171. Paul.Goldgisser Lv 1 1 pt. 7,561
  2. Avatar for Tac1 172. Tac1 Lv 1 1 pt. 7,559
  3. Avatar for metafolder 173. metafolder Lv 1 1 pt. 7,535
  4. Avatar for waldo7495 174. waldo7495 Lv 1 1 pt. 7,521
  5. Avatar for nvv21 175. nvv21 Lv 1 1 pt. 7,479
  6. Avatar for pizpot 176. pizpot Lv 1 1 pt. 7,471
  7. Avatar for apparentlyleopard 177. apparentlyleopard Lv 1 1 pt. 7,468
  8. Avatar for pixfix 178. pixfix Lv 1 1 pt. 7,458
  9. Avatar for nmos1056 179. nmos1056 Lv 1 1 pt. 7,446
  10. Avatar for Fowardint 180. Fowardint Lv 1 1 pt. 7,440

Comments