Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups


  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116

  1. Avatar for Scopper
    1. Scopper Lv 1
    100 pts. 9,352
  2. Avatar for mimi 2. mimi Lv 1 98 pts. 9,351
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 96 pts. 9,349
  4. Avatar for bertro 4. bertro Lv 1 94 pts. 9,343
  5. Avatar for Susume 5. Susume Lv 1 92 pts. 9,342
  6. Avatar for justjustin 6. justjustin Lv 1 90 pts. 9,341
  7. Avatar for gitwut 7. gitwut Lv 1 88 pts. 9,330
  8. Avatar for Galaxie 8. Galaxie Lv 1 86 pts. 9,320
  9. Avatar for hansvandenhof 9. hansvandenhof Lv 1 84 pts. 9,307
  10. Avatar for Threeoak 10. Threeoak Lv 1 82 pts. 9,304

Comments