Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,023
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 0
  1. Avatar for Scopper
    1. Scopper Lv 1
    100 pts. 9,352
  2. Avatar for mimi 2. mimi Lv 1 98 pts. 9,351
  3. Avatar for retiredmichael 3. retiredmichael Lv 1 96 pts. 9,349
  4. Avatar for bertro 4. bertro Lv 1 94 pts. 9,343
  5. Avatar for Susume 5. Susume Lv 1 92 pts. 9,342
  6. Avatar for justjustin 6. justjustin Lv 1 90 pts. 9,341
  7. Avatar for gitwut 7. gitwut Lv 1 88 pts. 9,330
  8. Avatar for Galaxie 8. Galaxie Lv 1 86 pts. 9,320
  9. Avatar for hansvandenhof 9. hansvandenhof Lv 1 84 pts. 9,307
  10. Avatar for Threeoak 10. Threeoak Lv 1 82 pts. 9,304

Comments