Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for val.sch67 191. val.sch67 Lv 1 1 pt. 7,098
  2. Avatar for 341441 192. 341441 Lv 1 1 pt. 6,885
  3. Avatar for lockert 193. lockert Lv 1 1 pt. 6,718
  4. Avatar for AgastyaTripathi 194. AgastyaTripathi Lv 1 1 pt. 6,622
  5. Avatar for jaket86 195. jaket86 Lv 1 1 pt. 6,479
  6. Avatar for penteplayer 196. penteplayer Lv 1 1 pt. 6,333
  7. Avatar for StpPls 197. StpPls Lv 1 1 pt. 6,316
  8. Avatar for briemoney 198. briemoney Lv 1 1 pt. 6,247
  9. Avatar for aspadistra 199. aspadistra Lv 1 1 pt. 6,116
  10. Avatar for jflat06 200. jflat06 Lv 1 1 pt. 6,023

Comments