Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for grogar7 41. grogar7 Lv 1 38 pts. 9,134
  2. Avatar for Mike Cassidy 42. Mike Cassidy Lv 1 37 pts. 9,133
  3. Avatar for sheerbliss 43. sheerbliss Lv 1 36 pts. 9,132
  4. Avatar for Blipperman 44. Blipperman Lv 1 35 pts. 9,110
  5. Avatar for uhuuhu 45. uhuuhu Lv 1 34 pts. 9,104
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 33 pts. 9,104
  7. Avatar for isaksson 47. isaksson Lv 1 32 pts. 9,099
  8. Avatar for Apollos42 48. Apollos42 Lv 1 31 pts. 9,089
  9. Avatar for fiendish_ghoul 49. fiendish_ghoul Lv 1 30 pts. 9,088
  10. Avatar for jobo0502 50. jobo0502 Lv 1 29 pts. 9,087

Comments