Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for freefolder 11. freefolder 4 pts. 8,851
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 3 pts. 8,802
  3. Avatar for Deleted group 13. Deleted group pts. 8,739
  4. Avatar for It's over 9000! 14. It's over 9000! 1 pt. 8,637
  5. Avatar for xkcd 15. xkcd 1 pt. 8,420
  6. Avatar for Rice Biochemistry 16. Rice Biochemistry 1 pt. 7,484
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 7,294
  8. Avatar for Deleted group 18. Deleted group pts. 7,120
  9. Avatar for Seymour High School Honors Biology I 2018 19. Seymour High School Honors Biology I 2018 1 pt. 6,479
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 6,116
  1. Avatar for pvc78 51. pvc78 Lv 1 29 pts. 9,086
  2. Avatar for Satina 52. Satina Lv 1 28 pts. 9,080
  3. Avatar for Achronidas 53. Achronidas Lv 1 27 pts. 9,080
  4. Avatar for TomTaylor 54. TomTaylor Lv 1 26 pts. 9,076
  5. Avatar for crpainter 55. crpainter Lv 1 25 pts. 9,062
  6. Avatar for spvincent 56. spvincent Lv 1 25 pts. 9,060
  7. Avatar for Vinara 57. Vinara Lv 1 24 pts. 9,052
  8. Avatar for Crossed Sticks 58. Crossed Sticks Lv 1 23 pts. 9,043
  9. Avatar for Glen B 59. Glen B Lv 1 23 pts. 9,040
  10. Avatar for jamiexq 60. jamiexq Lv 1 22 pts. 9,038

Comments