Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,023
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 0
  1. Avatar for lynnai 31. lynnai Lv 1 49 pts. 9,193
  2. Avatar for hpaege 32. hpaege Lv 1 48 pts. 9,192
  3. Avatar for Bruno Kestemont 33. Bruno Kestemont Lv 1 47 pts. 9,192
  4. Avatar for gloverd 34. gloverd Lv 1 45 pts. 9,191
  5. Avatar for smilingone 35. smilingone Lv 1 44 pts. 9,185
  6. Avatar for christioanchauvin 36. christioanchauvin Lv 1 43 pts. 9,175
  7. Avatar for nicobul 37. nicobul Lv 1 42 pts. 9,167
  8. Avatar for dcrwheeler 38. dcrwheeler Lv 1 41 pts. 9,165
  9. Avatar for Bletchley Park 39. Bletchley Park Lv 1 40 pts. 9,156
  10. Avatar for Museka 40. Museka Lv 1 39 pts. 9,154

Comments