Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups


  1. Avatar for Window Group 21. Window Group 1 pt. 6,023

  1. Avatar for grogar7 41. grogar7 Lv 1 38 pts. 9,134
  2. Avatar for Mike Cassidy 42. Mike Cassidy Lv 1 37 pts. 9,133
  3. Avatar for sheerbliss 43. sheerbliss Lv 1 36 pts. 9,132
  4. Avatar for Blipperman 44. Blipperman Lv 1 35 pts. 9,110
  5. Avatar for uhuuhu 45. uhuuhu Lv 1 34 pts. 9,104
  6. Avatar for Anfinsen_slept_here 46. Anfinsen_slept_here Lv 1 33 pts. 9,104
  7. Avatar for isaksson 47. isaksson Lv 1 32 pts. 9,099
  8. Avatar for Apollos42 48. Apollos42 Lv 1 31 pts. 9,089
  9. Avatar for fiendish_ghoul 49. fiendish_ghoul Lv 1 30 pts. 9,088
  10. Avatar for jobo0502 50. jobo0502 Lv 1 29 pts. 9,087

Comments