Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,023
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 0
  1. Avatar for pvc78 51. pvc78 Lv 1 29 pts. 9,086
  2. Avatar for Satina 52. Satina Lv 1 28 pts. 9,080
  3. Avatar for Achronidas 53. Achronidas Lv 1 27 pts. 9,080
  4. Avatar for TomTaylor 54. TomTaylor Lv 1 26 pts. 9,076
  5. Avatar for crpainter 55. crpainter Lv 1 25 pts. 9,062
  6. Avatar for spvincent 56. spvincent Lv 1 25 pts. 9,060
  7. Avatar for Vinara 57. Vinara Lv 1 24 pts. 9,052
  8. Avatar for Crossed Sticks 58. Crossed Sticks Lv 1 23 pts. 9,043
  9. Avatar for Glen B 59. Glen B Lv 1 23 pts. 9,040
  10. Avatar for jamiexq 60. jamiexq Lv 1 22 pts. 9,038

Comments