Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Window Group 21. Window Group 1 pt. 6,023
  2. Avatar for Team South Africa 22. Team South Africa 1 pt. 0
  1. Avatar for Andi1960 81. Andi1960 Lv 1 11 pts. 8,878
  2. Avatar for JMStiffler 82. JMStiffler Lv 1 11 pts. 8,876
  3. Avatar for t012 83. t012 Lv 1 11 pts. 8,870
  4. Avatar for Azukay 84. Azukay Lv 1 10 pts. 8,868
  5. Avatar for drumpeter18yrs9yrs 85. drumpeter18yrs9yrs Lv 1 10 pts. 8,865
  6. Avatar for Deleted player 86. Deleted player pts. 8,855
  7. Avatar for Altercomp 87. Altercomp Lv 1 9 pts. 8,851
  8. Avatar for YGK 88. YGK Lv 1 9 pts. 8,848
  9. Avatar for Mike Lewis 89. Mike Lewis Lv 1 9 pts. 8,841
  10. Avatar for stomjoh 90. stomjoh Lv 1 8 pts. 8,833

Comments