Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for KarenCH 11. KarenCH Lv 1 80 pts. 9,301
  2. Avatar for nemo7731 12. nemo7731 Lv 1 78 pts. 9,298
  3. Avatar for Deleted player 13. Deleted player pts. 9,294
  4. Avatar for phi16 14. phi16 Lv 1 75 pts. 9,293
  5. Avatar for gmn 15. gmn Lv 1 73 pts. 9,291
  6. Avatar for actiasluna 16. actiasluna Lv 1 71 pts. 9,289
  7. Avatar for Mark- 17. Mark- Lv 1 69 pts. 9,278
  8. Avatar for MurloW 18. MurloW Lv 1 68 pts. 9,278
  9. Avatar for Madde 19. Madde Lv 1 66 pts. 9,270
  10. Avatar for LociOiling 20. LociOiling Lv 1 65 pts. 9,249

Comments