Placeholder image of a protein
Icon representing a puzzle

1200: Unsolved De-novo Freestyle 71

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
February 27, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


TEDIKKWIEEMKKEVKKGGGERLKELLKELEKRIKSKGKTVRIEFQERGRIEIEIEGNIRIEIES

Top groups

  1. Avatar for Go Science
    1. Go Science
    100 pts. 9,395
  2. Avatar for Contenders 2. Contenders 79 pts. 9,355
  3. Avatar for Anthropic Dreams 3. Anthropic Dreams 61 pts. 9,353
  4. Avatar for Beta Folders 4. Beta Folders 47 pts. 9,351
  5. Avatar for Gargleblasters 5. Gargleblasters 35 pts. 9,316
  6. Avatar for Void Crushers 6. Void Crushers 26 pts. 9,270
  7. Avatar for HMT heritage 7. HMT heritage 19 pts. 9,195
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 14 pts. 9,175
  9. Avatar for Deleted group 9. Deleted group pts. 9,104
  10. Avatar for BOINC@Poland 10. BOINC@Poland 7 pts. 8,899
  1. Avatar for pauldunn 21. pauldunn Lv 1 63 pts. 9,247
  2. Avatar for g_b 22. g_b Lv 1 61 pts. 9,242
  3. Avatar for reefyrob 23. reefyrob Lv 1 60 pts. 9,238
  4. Avatar for jermainiac 24. jermainiac Lv 1 59 pts. 9,237
  5. Avatar for Timo van der Laan 25. Timo van der Laan Lv 1 57 pts. 9,236
  6. Avatar for frood66 26. frood66 Lv 1 56 pts. 9,234
  7. Avatar for johnmitch 27. johnmitch Lv 1 54 pts. 9,211
  8. Avatar for steveB 28. steveB Lv 1 53 pts. 9,210
  9. Avatar for Skippysk8s 29. Skippysk8s Lv 1 52 pts. 9,208
  10. Avatar for O Seki To 30. O Seki To Lv 1 50 pts. 9,195

Comments