Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for BOINC@Poland 11. BOINC@Poland 5 pts. 9,751
  2. Avatar for Natural Abilities 12. Natural Abilities 4 pts. 9,664
  3. Avatar for xkcd 13. xkcd 2 pts. 9,550
  4. Avatar for Minions of TWIS 14. Minions of TWIS 2 pts. 9,452
  5. Avatar for freefolder 15. freefolder 1 pt. 9,327
  6. Avatar for Mojo Risin' 16. Mojo Risin' 1 pt. 9,226
  7. Avatar for Eὕρηκα! Heureka! 17. Eὕρηκα! Heureka! 1 pt. 9,203
  8. Avatar for Team South Africa 18. Team South Africa 1 pt. 9,117
  9. Avatar for Deleted group 19. Deleted group pts. 9,102
  10. Avatar for DSN @ Home 20. DSN @ Home 1 pt. 9,076
  1. Avatar for DrTree 181. DrTree Lv 1 1 pt. 9,133
  2. Avatar for Cerzax 182. Cerzax Lv 1 1 pt. 9,124
  3. Avatar for khendarg 183. khendarg Lv 1 1 pt. 9,122
  4. Avatar for doctaven 184. doctaven Lv 1 1 pt. 9,117
  5. Avatar for Gracier 185. Gracier Lv 1 1 pt. 9,105
  6. Avatar for Close At Hand 186. Close At Hand Lv 1 1 pt. 9,102
  7. Avatar for mdmarkow 187. mdmarkow Lv 1 1 pt. 9,102
  8. Avatar for Argantyr 188. Argantyr Lv 1 1 pt. 9,089
  9. Avatar for justjustin 189. justjustin Lv 1 1 pt. 9,085
  10. Avatar for tzabaoth 190. tzabaoth Lv 1 1 pt. 9,083

Comments

spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?