Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Intermediate Intermediate Intermediate Intermediate Intermediate Overall Overall Overall Overall Overall Overall Prediction Prediction Prediction Prediction Prediction Prediction

Summary


Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485

  1. Avatar for dahast.de 151. dahast.de Lv 1 1 pt. 9,265
  2. Avatar for Mike Cassidy 152. Mike Cassidy Lv 1 1 pt. 9,262
  3. Avatar for Auntecedent 153. Auntecedent Lv 1 1 pt. 9,261
  4. Avatar for penteplayer 154. penteplayer Lv 1 1 pt. 9,253
  5. Avatar for Azukay 155. Azukay Lv 1 1 pt. 9,250
  6. Avatar for DScott 156. DScott Lv 1 1 pt. 9,248
  7. Avatar for severin333 157. severin333 Lv 1 1 pt. 9,244
  8. Avatar for bwkittitas 158. bwkittitas Lv 1 1 pt. 9,232
  9. Avatar for senor pit 159. senor pit Lv 1 1 pt. 9,230
  10. Avatar for Tlaloc 160. Tlaloc Lv 1 1 pt. 9,226

Comments


spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?