Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,013
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,990
  3. Avatar for Void Crushers 3. Void Crushers 63 pts. 9,967
  4. Avatar for Contenders 4. Contenders 49 pts. 9,933
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 9,928
  6. Avatar for Go Science 6. Go Science 28 pts. 9,921
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 9,886
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 9,869
  9. Avatar for Deleted group 9. Deleted group pts. 9,816
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,766
  1. Avatar for dahast.de 151. dahast.de Lv 1 1 pt. 9,265
  2. Avatar for Mike Cassidy 152. Mike Cassidy Lv 1 1 pt. 9,262
  3. Avatar for Auntecedent 153. Auntecedent Lv 1 1 pt. 9,261
  4. Avatar for penteplayer 154. penteplayer Lv 1 1 pt. 9,253
  5. Avatar for Azukay 155. Azukay Lv 1 1 pt. 9,250
  6. Avatar for DScott 156. DScott Lv 1 1 pt. 9,248
  7. Avatar for severin333 157. severin333 Lv 1 1 pt. 9,244
  8. Avatar for bwkittitas 158. bwkittitas Lv 1 1 pt. 9,232
  9. Avatar for senor pit 159. senor pit Lv 1 1 pt. 9,230
  10. Avatar for Tlaloc 160. Tlaloc Lv 1 1 pt. 9,226

Comments

spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?