Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups


  1. Avatar for Rice Biochemistry 21. Rice Biochemistry 1 pt. 9,038
  2. Avatar for Deleted group 22. Deleted group pts. 8,950
  3. Avatar for Window Group 23. Window Group 1 pt. 8,485

  1. Avatar for lockert 171. lockert Lv 1 1 pt. 9,176
  2. Avatar for Psych0Active 172. Psych0Active Lv 1 1 pt. 9,167
  3. Avatar for isantheautumn 173. isantheautumn Lv 1 1 pt. 9,167
  4. Avatar for mirjamvandelft 174. mirjamvandelft Lv 1 1 pt. 9,164
  5. Avatar for X9DW 175. X9DW Lv 1 1 pt. 9,153
  6. Avatar for momadoc 176. momadoc Lv 1 1 pt. 9,148
  7. Avatar for parsnip 177. parsnip Lv 1 1 pt. 9,147
  8. Avatar for d.pierre 178. d.pierre Lv 1 1 pt. 9,144
  9. Avatar for emily.statham 179. emily.statham Lv 1 1 pt. 9,136
  10. Avatar for Blesya 180. Blesya Lv 1 1 pt. 9,133

Comments


spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?