Placeholder image of a protein
Icon representing a puzzle

1201: Revisiting Puzzle 140: Rosetta Decoy 4

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 01, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains four cysteine residues, but in this state only two of them are expected to oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


MPVNQIQETISDNCVVIFSKTSCSYCTMAKKLFHDMNVNYKVVELDLLEYGNQFQDALYKMTGERTVPRIFVNGTFIGGATDTHRLHKEGKLLPLVHQCYL

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,013
  2. Avatar for Anthropic Dreams 2. Anthropic Dreams 80 pts. 9,990
  3. Avatar for Void Crushers 3. Void Crushers 63 pts. 9,967
  4. Avatar for Contenders 4. Contenders 49 pts. 9,933
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 9,928
  6. Avatar for Go Science 6. Go Science 28 pts. 9,921
  7. Avatar for HMT heritage 7. HMT heritage 21 pts. 9,886
  8. Avatar for Gargleblasters 8. Gargleblasters 15 pts. 9,869
  9. Avatar for Deleted group 9. Deleted group pts. 9,816
  10. Avatar for Italiani Al Lavoro 10. Italiani Al Lavoro 8 pts. 9,766
  1. Avatar for lockert 171. lockert Lv 1 1 pt. 9,176
  2. Avatar for Psych0Active 172. Psych0Active Lv 1 1 pt. 9,167
  3. Avatar for isantheautumn 173. isantheautumn Lv 1 1 pt. 9,167
  4. Avatar for mirjamvandelft 174. mirjamvandelft Lv 1 1 pt. 9,164
  5. Avatar for X9DW 175. X9DW Lv 1 1 pt. 9,153
  6. Avatar for momadoc 176. momadoc Lv 1 1 pt. 9,148
  7. Avatar for parsnip 177. parsnip Lv 1 1 pt. 9,147
  8. Avatar for d.pierre 178. d.pierre Lv 1 1 pt. 9,144
  9. Avatar for emily.statham 179. emily.statham Lv 1 1 pt. 9,136
  10. Avatar for Blesya 180. Blesya Lv 1 1 pt. 9,133

Comments

spvincent Lv 1

This is, I believe, the 71st such throwback puzzle.

How many more are going to needed before whoever's responsible for looking at the results decides that enough data has been obtained to determine how useful the game additions have been?