Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 9,818
  2. Avatar for xkcd 12. xkcd 4 pts. 9,688
  3. Avatar for Bad Monkey 13. Bad Monkey 2 pts. 9,517
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 9,463
  5. Avatar for Deleted group 15. Deleted group pts. 9,400
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,394
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 9,347
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,258
  9. Avatar for freefolder 19. freefolder 1 pt. 9,216
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 9,086
  1. Avatar for tela 111. tela Lv 1 5 pts. 9,467
  2. Avatar for doctaven 112. doctaven Lv 1 5 pts. 9,463
  3. Avatar for brow42 113. brow42 Lv 1 4 pts. 9,461
  4. Avatar for cherry39 114. cherry39 Lv 1 4 pts. 9,452
  5. Avatar for bendbob 115. bendbob Lv 1 4 pts. 9,444
  6. Avatar for SouperGenious 116. SouperGenious Lv 1 4 pts. 9,439
  7. Avatar for jebbiek 117. jebbiek Lv 1 4 pts. 9,432
  8. Avatar for TheStaticSloth 118. TheStaticSloth Lv 1 4 pts. 9,424
  9. Avatar for severin333 119. severin333 Lv 1 3 pts. 9,424
  10. Avatar for Apollos42 120. Apollos42 Lv 1 3 pts. 9,423

Comments