1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since almost 10 years ago

Summary

• Created: March 08, 2016
• Expires: March 16, 2016 at 18:00 UTC
• Max points: 100

Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:

SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

• 1. Beta Folders 100 pts. 10,127
• 2. Go Science 80 pts. 10,114
• 3. Contenders 63 pts. 10,081
• 4. Anthropic Dreams 49 pts. 10,064
• 5. L'Alliance Francophone 37 pts. 10,031
• 6. Void Crushers 28 pts. 10,009
• 7. Gargleblasters 21 pts. 10,009
• 8. Deleted group pts. 9,945
• 9. HMT heritage 11 pts. 9,928
• 10. BOINC@Poland 8 pts. 9,819

Top soloists

• 1. LociOiling 100 pts. 10,125
• 2. pauldunn 98 pts. 10,105
• 3. Bruno Kestemont 96 pts. 10,098
• 4. retiredmichael 94 pts. 10,085
• 5. gitwut 92 pts. 10,075
• 6. reefyrob 90 pts. 10,068
• 7. Galaxie 88 pts. 10,062
• 8. gloverd 86 pts. 10,048
• 9. gmn 85 pts. 10,040
• 10. johnmitch 83 pts. 10,038