Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Beta Folders 100 pts. 10,127
  2. Avatar for Go Science 2. Go Science 80 pts. 10,114
  3. Avatar for Contenders 3. Contenders 63 pts. 10,081
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 10,064
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,031
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 10,009
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 10,009
  8. Avatar for Deleted group 8. Deleted group pts. 9,945
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,928
  10. Avatar for BOINC@Poland 10. BOINC@Poland 8 pts. 9,819

  1. Avatar for LociOiling
    1. LociOiling Lv 1
    100 pts. 10,125
  2. Avatar for pauldunn 2. pauldunn Lv 1 98 pts. 10,105
  3. Avatar for Bruno Kestemont 3. Bruno Kestemont Lv 1 96 pts. 10,098
  4. Avatar for retiredmichael 4. retiredmichael Lv 1 94 pts. 10,085
  5. Avatar for gitwut 5. gitwut Lv 1 92 pts. 10,075
  6. Avatar for reefyrob 6. reefyrob Lv 1 90 pts. 10,068
  7. Avatar for Galaxie 7. Galaxie Lv 1 88 pts. 10,062
  8. Avatar for gloverd 8. gloverd Lv 1 86 pts. 10,048
  9. Avatar for gmn 9. gmn Lv 1 85 pts. 10,040
  10. Avatar for johnmitch 10. johnmitch Lv 1 83 pts. 10,038

Comments