Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Intermediate Overall Overall Prediction Prediction

Summary


Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 9,818
  2. Avatar for xkcd 12. xkcd 4 pts. 9,688
  3. Avatar for Bad Monkey 13. Bad Monkey 2 pts. 9,517
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 9,463
  5. Avatar for Deleted group 15. Deleted group pts. 9,400
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,394
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 9,347
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,258
  9. Avatar for freefolder 19. freefolder 1 pt. 9,216
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 9,086

  1. Avatar for guineapig 131. guineapig Lv 1 2 pts. 9,375
  2. Avatar for xplocast1 132. xplocast1 Lv 1 2 pts. 9,375
  3. Avatar for pandapharmd 133. pandapharmd Lv 1 2 pts. 9,373
  4. Avatar for ViJay7019 134. ViJay7019 Lv 1 2 pts. 9,371
  5. Avatar for cubbase 135. cubbase Lv 1 2 pts. 9,368
  6. Avatar for mitarcher 136. mitarcher Lv 1 2 pts. 9,355
  7. Avatar for Ronin-Sensei 137. Ronin-Sensei Lv 1 2 pts. 9,353
  8. Avatar for Mr_Jolty 138. Mr_Jolty Lv 1 2 pts. 9,347
  9. Avatar for martinf 139. martinf Lv 1 2 pts. 9,344
  10. Avatar for Dantoto 140. Dantoto Lv 1 2 pts. 9,343

Comments