Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 9,818
  2. Avatar for xkcd 12. xkcd 4 pts. 9,688
  3. Avatar for Bad Monkey 13. Bad Monkey 2 pts. 9,517
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 9,463
  5. Avatar for Deleted group 15. Deleted group pts. 9,400
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,394
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 9,347
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,258
  9. Avatar for freefolder 19. freefolder 1 pt. 9,216
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 9,086

  1. Avatar for wyattj 151. wyattj Lv 1 1 pt. 9,265
  2. Avatar for Jajaboman 152. Jajaboman Lv 1 1 pt. 9,258
  3. Avatar for Wheeler22 153. Wheeler22 Lv 1 1 pt. 9,229
  4. Avatar for lockert 154. lockert Lv 1 1 pt. 9,222
  5. Avatar for senor pit 155. senor pit Lv 1 1 pt. 9,218
  6. Avatar for lamoille 156. lamoille Lv 1 1 pt. 9,217
  7. Avatar for Altercomp 157. Altercomp Lv 1 1 pt. 9,216
  8. Avatar for anthonyamartin77 158. anthonyamartin77 Lv 1 1 pt. 9,191
  9. Avatar for pandabearsecond 159. pandabearsecond Lv 1 1 pt. 9,189
  10. Avatar for Fokin Bogdan 160. Fokin Bogdan Lv 1 1 pt. 9,177

Comments