Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 9,818
  2. Avatar for xkcd 12. xkcd 4 pts. 9,688
  3. Avatar for Bad Monkey 13. Bad Monkey 2 pts. 9,517
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 9,463
  5. Avatar for Deleted group 15. Deleted group pts. 9,400
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,394
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 9,347
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,258
  9. Avatar for freefolder 19. freefolder 1 pt. 9,216
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 9,086
  1. Avatar for Tac1 171. Tac1 Lv 1 1 pt. 9,125
  2. Avatar for itboswelll 172. itboswelll Lv 1 1 pt. 9,114
  3. Avatar for parsnip 173. parsnip Lv 1 1 pt. 9,107
  4. Avatar for momadoc 174. momadoc Lv 1 1 pt. 9,105
  5. Avatar for DScott 175. DScott Lv 1 1 pt. 9,105
  6. Avatar for bwkittitas 176. bwkittitas Lv 1 1 pt. 9,104
  7. Avatar for bzipitidoo 177. bzipitidoo Lv 1 1 pt. 9,099
  8. Avatar for NotJim99 178. NotJim99 Lv 1 1 pt. 9,092
  9. Avatar for STEMIOB_BKAMAN 179. STEMIOB_BKAMAN Lv 1 1 pt. 9,090
  10. Avatar for Savas 180. Savas Lv 1 1 pt. 9,086

Comments