Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary


Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups


  1. Avatar for Italiani Al Lavoro 11. Italiani Al Lavoro 5 pts. 9,818
  2. Avatar for xkcd 12. xkcd 4 pts. 9,688
  3. Avatar for Bad Monkey 13. Bad Monkey 2 pts. 9,517
  4. Avatar for Team South Africa 14. Team South Africa 2 pts. 9,463
  5. Avatar for Deleted group 15. Deleted group pts. 9,400
  6. Avatar for Minions of TWIS 16. Minions of TWIS 1 pt. 9,394
  7. Avatar for Natural Abilities 17. Natural Abilities 1 pt. 9,347
  8. Avatar for FoldIt@Netherlands 18. FoldIt@Netherlands 1 pt. 9,258
  9. Avatar for freefolder 19. freefolder 1 pt. 9,216
  10. Avatar for Eὕρηκα! Heureka! 20. Eὕρηκα! Heureka! 1 pt. 9,086

  1. Avatar for nicobul 11. nicobul Lv 1 81 pts. 10,031
  2. Avatar for Deleted player 12. Deleted player pts. 10,028
  3. Avatar for Mark- 13. Mark- Lv 1 77 pts. 10,020
  4. Avatar for Scopper 14. Scopper Lv 1 76 pts. 10,018
  5. Avatar for mimi 15. mimi Lv 1 74 pts. 10,011
  6. Avatar for Timo van der Laan 16. Timo van der Laan Lv 1 72 pts. 10,009
  7. Avatar for Blipperman 17. Blipperman Lv 1 71 pts. 10,009
  8. Avatar for Bletchley Park 18. Bletchley Park Lv 1 69 pts. 9,996
  9. Avatar for g_b 19. g_b Lv 1 68 pts. 9,994
  10. Avatar for actiasluna 20. actiasluna Lv 1 66 pts. 9,992

Comments