1204: Revisiting Puzzle 141: Rosetta Decoy 5
Closed since about 10 years ago
Intermediate Intermediate Overall Overall Prediction PredictionSummary
- Created
- March 08, 2016
- Expires
- Max points
- 100
This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.
Sequence:
SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN
