Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 9,046
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 9,020
  3. Avatar for Window Group 23. Window Group 1 pt. 8,577
  1. Avatar for guineapig 131. guineapig Lv 1 2 pts. 9,375
  2. Avatar for xplocast1 132. xplocast1 Lv 1 2 pts. 9,375
  3. Avatar for pandapharmd 133. pandapharmd Lv 1 2 pts. 9,373
  4. Avatar for ViJay7019 134. ViJay7019 Lv 1 2 pts. 9,371
  5. Avatar for cubbase 135. cubbase Lv 1 2 pts. 9,368
  6. Avatar for mitarcher 136. mitarcher Lv 1 2 pts. 9,355
  7. Avatar for Ronin-Sensei 137. Ronin-Sensei Lv 1 2 pts. 9,353
  8. Avatar for Mr_Jolty 138. Mr_Jolty Lv 1 2 pts. 9,347
  9. Avatar for martinf 139. martinf Lv 1 2 pts. 9,344
  10. Avatar for Dantoto 140. Dantoto Lv 1 2 pts. 9,343

Comments