Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 9,046
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 9,020
  3. Avatar for Window Group 23. Window Group 1 pt. 8,577
  1. Avatar for wyattj 151. wyattj Lv 1 1 pt. 9,265
  2. Avatar for Jajaboman 152. Jajaboman Lv 1 1 pt. 9,258
  3. Avatar for Wheeler22 153. Wheeler22 Lv 1 1 pt. 9,229
  4. Avatar for lockert 154. lockert Lv 1 1 pt. 9,222
  5. Avatar for senor pit 155. senor pit Lv 1 1 pt. 9,218
  6. Avatar for lamoille 156. lamoille Lv 1 1 pt. 9,217
  7. Avatar for Altercomp 157. Altercomp Lv 1 1 pt. 9,216
  8. Avatar for anthonyamartin77 158. anthonyamartin77 Lv 1 1 pt. 9,191
  9. Avatar for pandabearsecond 159. pandabearsecond Lv 1 1 pt. 9,189
  10. Avatar for Fokin Bogdan 160. Fokin Bogdan Lv 1 1 pt. 9,177

Comments