Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 9,046
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 9,020
  3. Avatar for Window Group 23. Window Group 1 pt. 8,577
  1. Avatar for Tac1 171. Tac1 Lv 1 1 pt. 9,125
  2. Avatar for itboswelll 172. itboswelll Lv 1 1 pt. 9,114
  3. Avatar for parsnip 173. parsnip Lv 1 1 pt. 9,107
  4. Avatar for momadoc 174. momadoc Lv 1 1 pt. 9,105
  5. Avatar for DScott 175. DScott Lv 1 1 pt. 9,105
  6. Avatar for bwkittitas 176. bwkittitas Lv 1 1 pt. 9,104
  7. Avatar for bzipitidoo 177. bzipitidoo Lv 1 1 pt. 9,099
  8. Avatar for NotJim99 178. NotJim99 Lv 1 1 pt. 9,092
  9. Avatar for STEMIOB_BKAMAN 179. STEMIOB_BKAMAN Lv 1 1 pt. 9,090
  10. Avatar for Savas 180. Savas Lv 1 1 pt. 9,086

Comments