Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Deleted group 21. Deleted group pts. 9,046
  2. Avatar for DSN @ Home 22. DSN @ Home 1 pt. 9,020
  3. Avatar for Window Group 23. Window Group 1 pt. 8,577
  1. Avatar for cobaltteal 31. cobaltteal Lv 1 51 pts. 9,932
  2. Avatar for christioanchauvin 32. christioanchauvin Lv 1 50 pts. 9,928
  3. Avatar for O Seki To 33. O Seki To Lv 1 48 pts. 9,928
  4. Avatar for tallguy-13088 34. tallguy-13088 Lv 1 47 pts. 9,925
  5. Avatar for smholst 35. smholst Lv 1 46 pts. 9,911
  6. Avatar for pvc78 36. pvc78 Lv 1 45 pts. 9,904
  7. Avatar for smilingone 37. smilingone Lv 1 44 pts. 9,899
  8. Avatar for Satina 38. Satina Lv 1 43 pts. 9,893
  9. Avatar for pmdpmd 39. pmdpmd Lv 1 42 pts. 9,891
  10. Avatar for dcrwheeler 40. dcrwheeler Lv 1 41 pts. 9,890

Comments