Placeholder image of a protein
Icon representing a puzzle

1204: Revisiting Puzzle 141: Rosetta Decoy 5

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 08, 2016
Expires
Max points
100
Description

This is a throwback puzzle to the early days of Foldit. This protein helps to regulate oxidation in the cell; the starting structure is a model produced by Rosetta. This protein contains two cysteine residues, which oxidize to form a single disulfide bond. We are revisiting old Foldit puzzles so we can see how useful the recent additions to the game have been.



Sequence:


SKGVITITDAEFESEVLKAEQPVLVYFWASWCGPCQLMSPLINLAANTYSDRLKVVKLEIDPNPTTVKKYKVEGVPALRLVKGEQILDSTEGVISKDKLLSFLDTHLN

Top groups

  1. Avatar for Beta Folders
    1. Beta Folders
    100 pts. 10,127
  2. Avatar for Go Science 2. Go Science 80 pts. 10,114
  3. Avatar for Contenders 3. Contenders 63 pts. 10,081
  4. Avatar for Anthropic Dreams 4. Anthropic Dreams 49 pts. 10,064
  5. Avatar for L'Alliance Francophone 5. L'Alliance Francophone 37 pts. 10,031
  6. Avatar for Void Crushers 6. Void Crushers 28 pts. 10,009
  7. Avatar for Gargleblasters 7. Gargleblasters 21 pts. 10,009
  8. Avatar for Deleted group 8. Deleted group pts. 9,945
  9. Avatar for HMT heritage 9. HMT heritage 11 pts. 9,928
  10. Avatar for BOINC@Poland 10. BOINC@Poland 8 pts. 9,819
  1. Avatar for jermainiac 21. jermainiac Lv 1 1 pt. 10,052
  2. Avatar for bertro 22. bertro Lv 1 1 pt. 10,033
  3. Avatar for Deleted player 23. Deleted player pts. 10,032
  4. Avatar for Mark- 24. Mark- Lv 1 1 pt. 10,000
  5. Avatar for actiasluna 25. actiasluna Lv 1 1 pt. 9,970
  6. Avatar for Blipperman 26. Blipperman Lv 1 1 pt. 9,944
  7. Avatar for smholst 27. smholst Lv 1 1 pt. 9,940
  8. Avatar for grogar7 28. grogar7 Lv 1 1 pt. 9,936
  9. Avatar for alwen 29. alwen Lv 1 1 pt. 9,935
  10. Avatar for dbuske 30. dbuske Lv 1 1 pt. 9,927

Comments