Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for ViJay7019 101. ViJay7019 Lv 1 6 pts. 8,751
  2. Avatar for Bautho 102. Bautho Lv 1 6 pts. 8,747
  3. Avatar for boondog 103. boondog Lv 1 5 pts. 8,744
  4. Avatar for manu8170 104. manu8170 Lv 1 5 pts. 8,729
  5. Avatar for Superphosphate 105. Superphosphate Lv 1 5 pts. 8,727
  6. Avatar for arginia 106. arginia Lv 1 5 pts. 8,703
  7. Avatar for Mr_Jolty 107. Mr_Jolty Lv 1 5 pts. 8,685
  8. Avatar for hada 108. hada Lv 1 5 pts. 8,656
  9. Avatar for Merf 109. Merf Lv 1 4 pts. 8,639
  10. Avatar for tela 110. tela Lv 1 4 pts. 8,634

Comments