Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for citric acid 161. citric acid Lv 1 1 pt. 7,223
  2. Avatar for OnTheHook 162. OnTheHook Lv 1 1 pt. 7,181
  3. Avatar for pllq 163. pllq Lv 1 1 pt. 7,147
  4. Avatar for doctaven 164. doctaven Lv 1 1 pt. 7,146
  5. Avatar for kkkkkk 165. kkkkkk Lv 1 1 pt. 7,137
  6. Avatar for RedDragon88 166. RedDragon88 Lv 1 1 pt. 6,989
  7. Avatar for lulzhex 167. lulzhex Lv 1 1 pt. 6,882
  8. Avatar for larry25427 168. larry25427 Lv 1 1 pt. 6,844
  9. Avatar for MarcoP 169. MarcoP Lv 1 1 pt. 6,796
  10. Avatar for The_Lunar_1 170. The_Lunar_1 Lv 1 1 pt. 6,751

Comments