Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for reefyrob 11. reefyrob Lv 1 80 pts. 9,375
  2. Avatar for gitwut 12. gitwut Lv 1 78 pts. 9,371
  3. Avatar for actiasluna 13. actiasluna Lv 1 77 pts. 9,366
  4. Avatar for frood66 14. frood66 Lv 1 75 pts. 9,357
  5. Avatar for tarimo 15. tarimo Lv 1 73 pts. 9,352
  6. Avatar for justjustin 16. justjustin Lv 1 71 pts. 9,342
  7. Avatar for O Seki To 17. O Seki To Lv 1 70 pts. 9,340
  8. Avatar for phi16 18. phi16 Lv 1 68 pts. 9,332
  9. Avatar for Qfast 19. Qfast Lv 1 67 pts. 9,327
  10. Avatar for pauldunn 20. pauldunn Lv 1 65 pts. 9,326

Comments