Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for bendbob 21. bendbob Lv 1 63 pts. 9,323
  2. Avatar for mimi 22. mimi Lv 1 62 pts. 9,321
  3. Avatar for Mark- 23. Mark- Lv 1 60 pts. 9,321
  4. Avatar for andrewxc 24. andrewxc Lv 1 59 pts. 9,318
  5. Avatar for jamiexq 25. jamiexq Lv 1 58 pts. 9,315
  6. Avatar for nemo7731 26. nemo7731 Lv 1 56 pts. 9,315
  7. Avatar for nicobul 27. nicobul Lv 1 55 pts. 9,310
  8. Avatar for isaksson 28. isaksson Lv 1 53 pts. 9,307
  9. Avatar for Blipperman 29. Blipperman Lv 1 52 pts. 9,305
  10. Avatar for LociOiling 30. LociOiling Lv 1 51 pts. 9,299

Comments