Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for It's over 9000! 11. It's over 9000! 6 pts. 8,996
  2. Avatar for Italiani Al Lavoro 12. Italiani Al Lavoro 4 pts. 8,968
  3. Avatar for SETI.Germany 13. SETI.Germany 3 pts. 8,921
  4. Avatar for Natural Abilities 14. Natural Abilities 2 pts. 8,685
  5. Avatar for Mojo Risin' 15. Mojo Risin' 1 pt. 8,285
  6. Avatar for BOINC@Poland 16. BOINC@Poland 1 pt. 8,114
  7. Avatar for freefolder 17. freefolder 1 pt. 8,000
  8. Avatar for Russian team 18. Russian team 1 pt. 7,284
  9. Avatar for Team South Africa 19. Team South Africa 1 pt. 7,146
  10. Avatar for xkcd 20. xkcd 1 pt. 6,882
  1. Avatar for TomTaylor 71. TomTaylor Lv 1 16 pts. 8,990
  2. Avatar for smilingone 72. smilingone Lv 1 16 pts. 8,981
  3. Avatar for YGK 73. YGK Lv 1 15 pts. 8,973
  4. Avatar for deLaCeiba 74. deLaCeiba Lv 1 15 pts. 8,968
  5. Avatar for Rav3n_pl 75. Rav3n_pl Lv 1 14 pts. 8,964
  6. Avatar for snakeguy 76. snakeguy Lv 1 14 pts. 8,963
  7. Avatar for fishercat 77. fishercat Lv 1 13 pts. 8,937
  8. Avatar for Vinara 78. Vinara Lv 1 13 pts. 8,934
  9. Avatar for Schleicher 79. Schleicher Lv 1 13 pts. 8,921
  10. Avatar for YeshuaLives 80. YeshuaLives Lv 1 12 pts. 8,918

Comments