Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since about 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for uihcv 111. uihcv Lv 1 4 pts. 8,625
  2. Avatar for pfirth 112. pfirth Lv 1 4 pts. 8,622
  3. Avatar for darioarena 113. darioarena Lv 1 4 pts. 8,597
  4. Avatar for Jim Fraser 114. Jim Fraser Lv 1 4 pts. 8,580
  5. Avatar for TheStaticSloth 115. TheStaticSloth Lv 1 3 pts. 8,550
  6. Avatar for Ellis Shih 116. Ellis Shih Lv 1 3 pts. 8,472
  7. Avatar for harvardman 117. harvardman Lv 1 3 pts. 8,406
  8. Avatar for aiden123 118. aiden123 Lv 1 3 pts. 8,366
  9. Avatar for Punktchen 119. Punktchen Lv 1 3 pts. 8,325
  10. Avatar for momadoc 120. momadoc Lv 1 3 pts. 8,317

Comments