Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266
  1. Avatar for uihcv 111. uihcv Lv 1 4 pts. 8,625
  2. Avatar for pfirth 112. pfirth Lv 1 4 pts. 8,622
  3. Avatar for darioarena 113. darioarena Lv 1 4 pts. 8,597
  4. Avatar for Jim Fraser 114. Jim Fraser Lv 1 4 pts. 8,580
  5. Avatar for TheStaticSloth 115. TheStaticSloth Lv 1 3 pts. 8,550
  6. Avatar for Ellis Shih 116. Ellis Shih Lv 1 3 pts. 8,472
  7. Avatar for harvardman 117. harvardman Lv 1 3 pts. 8,406
  8. Avatar for aiden123 118. aiden123 Lv 1 3 pts. 8,366
  9. Avatar for Punktchen 119. Punktchen Lv 1 3 pts. 8,325
  10. Avatar for momadoc 120. momadoc Lv 1 3 pts. 8,317

Comments