Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for martinf 121. martinf Lv 1 3 pts. 8,304
  2. Avatar for Tlaloc 122. Tlaloc Lv 1 3 pts. 8,285
  3. Avatar for bwkittitas 123. bwkittitas Lv 1 3 pts. 8,252
  4. Avatar for parsnip 124. parsnip Lv 1 2 pts. 8,244
  5. Avatar for dahast.de 125. dahast.de Lv 1 2 pts. 8,175
  6. Avatar for xplocast1 126. xplocast1 Lv 1 2 pts. 8,155
  7. Avatar for itboswelll 127. itboswelll Lv 1 2 pts. 8,148
  8. Avatar for bob1928 128. bob1928 Lv 1 2 pts. 8,130
  9. Avatar for kitek314_pl 129. kitek314_pl Lv 1 2 pts. 8,114
  10. Avatar for dbuske 130. dbuske Lv 1 2 pts. 8,088

Comments