Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Anthropic Dreams
    1. Anthropic Dreams
    100 pts. 9,452
  2. Avatar for Beta Folders 2. Beta Folders 81 pts. 9,428
  3. Avatar for Bad Monkey 3. Bad Monkey 64 pts. 9,417
  4. Avatar for Go Science 4. Go Science 50 pts. 9,401
  5. Avatar for Gargleblasters 5. Gargleblasters 39 pts. 9,382
  6. Avatar for Contenders 6. Contenders 30 pts. 9,371
  7. Avatar for HMT heritage 7. HMT heritage 23 pts. 9,342
  8. Avatar for L'Alliance Francophone 8. L'Alliance Francophone 17 pts. 9,310
  9. Avatar for Void Crushers 9. Void Crushers 12 pts. 9,292
  10. Avatar for Deleted group 10. Deleted group pts. 9,266
  1. Avatar for martinf 121. martinf Lv 1 3 pts. 8,304
  2. Avatar for Tlaloc 122. Tlaloc Lv 1 3 pts. 8,285
  3. Avatar for bwkittitas 123. bwkittitas Lv 1 3 pts. 8,252
  4. Avatar for parsnip 124. parsnip Lv 1 2 pts. 8,244
  5. Avatar for dahast.de 125. dahast.de Lv 1 2 pts. 8,175
  6. Avatar for xplocast1 126. xplocast1 Lv 1 2 pts. 8,155
  7. Avatar for itboswelll 127. itboswelll Lv 1 2 pts. 8,148
  8. Avatar for bob1928 128. bob1928 Lv 1 2 pts. 8,130
  9. Avatar for kitek314_pl 129. kitek314_pl Lv 1 2 pts. 8,114
  10. Avatar for dbuske 130. dbuske Lv 1 2 pts. 8,088

Comments