Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for Wheeler22 151. Wheeler22 Lv 1 1 pt. 7,579
  2. Avatar for Hollinas 152. Hollinas Lv 1 1 pt. 7,564
  3. Avatar for Spero32 153. Spero32 Lv 1 1 pt. 7,483
  4. Avatar for ragadhousni 154. ragadhousni Lv 1 1 pt. 7,366
  5. Avatar for DrTree 155. DrTree Lv 1 1 pt. 7,353
  6. Avatar for RestrictionEndoNykolease 156. RestrictionEndoNykolease Lv 1 1 pt. 7,334
  7. Avatar for atomusuku 157. atomusuku Lv 1 1 pt. 7,284
  8. Avatar for CureForDiabetes 158. CureForDiabetes Lv 1 1 pt. 7,257
  9. Avatar for alejandroMadrid 159. alejandroMadrid Lv 1 1 pt. 7,255
  10. Avatar for ivalnic 160. ivalnic Lv 1 1 pt. 7,254

Comments