Placeholder image of a protein
Icon representing a puzzle

1206: Unsolved De-novo Freestyle 73

Closed since almost 10 years ago

Intermediate Overall Prediction

Summary

Created
March 12, 2016
Expires
Max points
100
Description

The structure of this protein is still unknown. Secondary structure predictions (from PSIPRED) are marked on the starting structure, and provide clues about where the protein might form helices and sheets!



Sequence:


QMEEMMKKLKKRFEELKKRGGDHELVKKMKEEVKKIKKLGPDYEVRMDLEVDPATGMVRIKVEIVGNGRTLELEVRVEK

Top groups

  1. Avatar for Chem251-601 Spring 2016 21. Chem251-601 Spring 2016 1 pt. 6,523
  2. Avatar for Medical Problem Solving II Home Page 22. Medical Problem Solving II Home Page 1 pt. 6,377
  3. Avatar for Deleted group 23. Deleted group pts. 5,622
  4. Avatar for DSN @ Home 24. DSN @ Home 1 pt. 5,452
  1. Avatar for TJOK fan 181. TJOK fan Lv 1 1 pt. 6,564
  2. Avatar for CAFN 182. CAFN Lv 1 1 pt. 6,538
  3. Avatar for maria_pl 183. maria_pl Lv 1 1 pt. 6,537
  4. Avatar for SMackoff_Chem251-601 184. SMackoff_Chem251-601 Lv 1 1 pt. 6,523
  5. Avatar for Tac1 185. Tac1 Lv 1 1 pt. 6,518
  6. Avatar for M Ghiorso iii 186. M Ghiorso iii Lv 1 1 pt. 6,455
  7. Avatar for Mydogisa Toelicker 187. Mydogisa Toelicker Lv 1 1 pt. 6,436
  8. Avatar for Pro Lapser 188. Pro Lapser Lv 1 1 pt. 6,404
  9. Avatar for PrettyPony2001 189. PrettyPony2001 Lv 1 1 pt. 6,403
  10. Avatar for NameChangeNeeded01 190. NameChangeNeeded01 Lv 1 1 pt. 6,401

Comments